PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr007673.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NAC
Protein Properties Length: 373aa    MW: 41554.9 Da    PI: 8.8471
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr007673.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.33.5e-5481361128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk..k 96 
                  lppGfrFhPtdeel+ +yL kkv++++l++ +vi+evdiyk++Pw+Lp+k++ +ekewyfFs+rd+ky++g r+nra++sgyWkatg+dk++++   +
  Pbr007673.1   8 LPPGFRFHPTDEELILHYLVKKVASTPLPV-SVIAEVDIYKFDPWELPAKAAFGEKEWYFFSPRDRKYPNGARPNRAAASGYWKATGTDKTIVAPsgG 104
                  79****************************.99***************988899***************************************99889 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                  g++vg+kk Lvfykgr pkg kt+W+mheyrl
  Pbr007673.1 105 GQNVGVKKALVFYKGRPPKGIKTNWIMHEYRL 136
                  999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.76E-666173IPR003441NAC domain
PROSITE profilePS5100562.7718173IPR003441NAC domain
PfamPF023653.7E-279136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MKNPESRLPP GFRFHPTDEE LILHYLVKKV ASTPLPVSVI AEVDIYKFDP WELPAKAAFG  60
EKEWYFFSPR DRKYPNGARP NRAAASGYWK ATGTDKTIVA PSGGGQNVGV KKALVFYKGR  120
PPKGIKTNWI MHEYRLPENP NNHTTTNHHH RVMKLKDLSM RLDDWVLCRI YKKSNVGTSA  180
VALPSDQNQE VQEEEDFLHD ILSPSLKSPF TGLDHNMMST SNTSSLKPQK SCSFSNLLDA  240
MDYSLLTSIL ADGQYSIPTG TGFQSTTPNK FSYSCTGSSS IGLDPQLLFN TDISSSSHLL  300
QTLPQYNGLN LPSSAPSTEN RLKRQHSITD DRGVLLCPSK KYVNSNCSFT NTANSFLNQQ  360
LLLSSPSFHF QE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B4e-73817517167NAC domain-containing protein 19
4dul_A4e-73817517167NAC domain-containing protein 19
1ut7_B4e-73817517167NO APICAL MERISTEM PROTEIN
1ut7_A4e-73817517167NO APICAL MERISTEM PROTEIN
1ut4_B4e-73817517167NO APICAL MERISTEM PROTEIN
1ut4_A4e-73817517167NO APICAL MERISTEM PROTEIN
3swp_D4e-73817520170NAC domain-containing protein 19
3swp_C4e-73817520170NAC domain-containing protein 19
3swp_B4e-73817520170NAC domain-containing protein 19
3swp_A4e-73817520170NAC domain-containing protein 19
3swm_D4e-73817520170NAC domain-containing protein 19
3swm_C4e-73817520170NAC domain-containing protein 19
3swm_B4e-73817520170NAC domain-containing protein 19
3swm_A4e-73817520170NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00333DAPTransfer from AT3G04070Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1981150.0KF198115.1 Malus hupehensis NAC domain protein (NAC24) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009366417.10.0PREDICTED: NAC transcription factor 29-like
SwissprotA0SPJ61e-89NAMB2_TRITD; NAC transcription factor NAM-B2
TrEMBLS5RDR30.0S5RDR3_9R
STRINGPOPTR_0019s04690.11e-128(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66212750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.11e-101NAC domain containing protein 47